Research Publications by Faculty
since November 2015
Dr. Kumar S P
- E-Governance and the Efficiency of Service Delivery at LSGs in Kerala”, ISDA Journal, Vol.26,No.3, July-September 2016, Trivandrum, ISSN 0971-2550. 2016.
- Effectiveness of E-Governance in Decentralised Planning An Evaluation based on Employees Perspectives, LOGOS – An Interdisciplinary Research Journal, Vol4(1), June 2016, Sree Narayana College, Chempazhanthi, Trivandrum, ISSN 2349- 3836.Pp. 05 13. 2016.
- Gender Budgeting- An Economic Initiative for Women Empowerment,International Journal of Educational Science and Research (IJESR), Vol. 8, Issue 1, Feb 2018, ISSN (P): 2249-6947; ISSN (E): 2249-8052, Impact Factor (JCC): 5.9865, NAAS Rating: 4.16, Pp.63-65. 2018.
- Scheduled Caste Students Participation in Technology and Innovation Studies: Explorative Study Among Higher Educational Institutions of Kerala, MIRROR, Vol.8, No.3, April,2018, (Special Issue), Peer Referred International Journal, ISSN 2249- 8117, UGC Approved Journal No. 64272, Kuravilangad,Kerala, Pp.234-238. 2018.
- Enduring Gender Gapsin the Access and Usage of Finance: Blockage Towards Sustainable Financial Inclusion, Journal of Banking, Information Technology and Management, ISSN No. 0972-902X,Vol.15, No.2,December 2018, UGC Approved Journal No. 44343, Research Development Research Foundation, Jaipur. 2018.
- Achieving the Goal of Education for All (Efa) In India: Prospects and Challenges, Indian Journal of Research,Vol.8, No.2, December 2018, ISSN No. 2231-6655, UGC Approval No.44228, Research and Development Foundation, Jaipur. 2018.
- Socio-Economic and Health Conditions of Nurses in Private Hospitals in Kerala- A Study with Special Reference to Kollam,Scholarly Research Journal for Interdisciplinary Studies, Vol. 6/48, ISSN No. 2278-8808, December 2018. wwwsrijs.com. 2018.
- Socio Economic Status of Women Guest Lectures in Collegiate Services in Kerala, International Journal of Creative Research Thoughts,ISSN No. 2320-2882, March 2018, Vol.7(1), www.ijcrt.org. 2018.
- Jeopardizing the Goal of Women Empowerment: A Case of Crime against Women, IJRAR, Vol.8, No.1, 2021 March, ISSN No. 2349-5138, Peer Reviewed, www.ijrar.org., Gujarat. 2021.
- Feminization of the Labour Force: Exploring the Missing Women Trend of Kerala’s Labour Market, IJRAR, Vol.8, No.1, 2021 March, ISSN No. 2349-5138, Peer Reviewed, www.ijrar.org., Gujarat. 2021.
- Political Economy of Alienation Among College Teachers, NIU International Journal of Human Rights, 2394-0298, UGC (Care Group-1), Volume 8(XXII), New Delhi. 2021.
- A Study on Responsible Tourism and its Potentialities with Special Reference to Jatayu Earth Centre, Kollam, IJRAR - International Journal of Research and Analytical Reviews (IJRAR), E-ISSN 2348-1269, P- ISSN 2349-5138, Volume.8, Issue 4, November 2021, Peer Reviewed, www.ijrar.org., Gujarat. 2021.
- Effectiveness of E- Governance on Service Delivery at LSGs- A Supply Side Evaluation”, ISDA Journal, ISSN 0971-2550, Vol.31,No.4, October-December 2021, Trivandrum. 2021.
Dr. Devipriya V.
- Evaluating genetic diversity within genus Jasminum L. (Oleaceae) using Intersimple Sequence Repeats (ISSR) marker. Proc. Natl. Acad. Sci. India, Sect. B. Biol. Sci. 2019.
- Phylogenetic analysis and evolution of morphological characters in the genus Jasminum L. (Oleaceae) in India. Journal of Genetics, 97 (5) : 1225-1239. 2018.
- Pollen morphological studies in five species of Leea D. Royen ex L. from Kerala. Int. J. Adv. Res. 6(9) : 869-876. – ISSN : 23205407. 2018.
- Molecular systematic study of two Solanaceous generaDatura L. and Brugmansia Pers. based on ITS sequences of nrDNA. Int. J. Adv. Res. 6(10) : 1123-1133. 2018.
Dr. Shymi K
- Does β-Catenin Cross-Regulate NFκB Signalling in Pancreatic Cancer and Chronic Pancreatitis?”, Pathobiology, Vol. 82, ISSN: DOI:10.1159/000369887, Pp. 28-35. 2015.
Dr. Binoy C
- Feeding biology of predatory mite Euseiusalstoniae (Gupta, 1975) (Family: Phytoseiidae) on red spider mite Tetranychusneocaledonicus (André, 1933) infesting Moringa oleifera Lam. Uttar Pradesh J. Zool. 35(2): 147–150. 2015.
- An unusual new species of AulacusJurine (Hymenoptera: Evanioidea: Aulacidae) from Southern Western Ghats, India. Zootaxa. 4686(2): 289–293. 2019.
- Extending the Australasian endemicity: first report of NeapterolelapsGirault and Thaumasura Westwood (Hymenoptera: Pteromalidae) from the Oriental Region with the description of new species from southern Western Ghats, India. Oriental Insects. 54(4): 481–495. 2019.
- First report of the genus ParapsilogastrusGhesquière (Hymenoptera: Chalcidoidea: Eucharitidae) from India with the description of a new species from southern Western Ghats. Journal of Environment &Sociobiology. 16(2): 133–137. 2019.
- Description of a new species of Lasiochalcidia Masi (Chalcidoidea: Chalcididae) from India with a key to Oriental species. Halteres. 10: 80–85. 2019.
- First discovery of a long-tailed wasp from the Indian subcontinent (Hymenoptera: Megalyroidea: Megalyridae). International Journal of Tropical Insect Science. 40:751–758. 2020.
- Description of a new species of spider wasp Genus Machaerothrix Haupt (Hymenoptera: Pompilidae) from India with reports on its host association and nesting behaviour. Zootaxa.4766(1): 192–200. 2020.
- A review of Stephanidae (Hymenoptera: Stephanoidea) from India, with the description of five new species. Zootaxa. 4838(1): 001–051. 2020.
- Review of the aberrant spider wasp genus Irenangelus Schulz (Pompilidae: Ceropalinae) from the Indian subcontinent with the description of a new species. Zootaxa.4860(2): 257–266. 2020.
- A new species of Foenatopus Smith (Hymenoptera: Stephanidae) from Andaman Islands, India. Zootaxa. 4869(2): 290–294. 2020.
- A new report on the parasitisation of Epitranus Walker (Chalcidoidea: Chalcididae) on Phereoecauterella (Walsingham) (Lepidoptera: Tineidae) with the description of a new species from India. Oriental Insects. 1–9. 2020.
- A new species of square-headed wasp DasyproctusLepeletier&Brullé (Hymenoptera: Crabronidae: Crabronini) from India, with notes on its biology. Zootaxa. 4920(2): 223–234. 2021.
- A Checklist of Stephanidae (Insecta: Hymenoptera: Stephanoidea) of India. Version 1.0. updated till March 2021. available at http://zsi.gov.in (online only). 2021.
- A Checklist of Chalcididae (Insecta: Hymenoptera: Chalcidoidea) of India. Version 1.0. updated till March 2021. available at http://zsi.gov.in (online only). 2021.
- A review of the mud-dauber wasps of genus Sceliphron Klug (Hymenoptera: Sphecidae) from India. Zootaxa. 4969 (1): 061–085. 2021.
- Review of SmicromorphaGirault (Hymenoptera: Chalcididae) with description of a new species from India. Zootaxa. 4991 (1): 131–149. 2021.
- Review of Indian DasyproctusLepeletier&Brullé 1835 (Hymenoptera: Crabronidae) with description of four new species. Zootaxa. 4991 (3): 467–498. 2021.
- Two new species of wasps parasitizing the rare gelechid defoliator Coconymphairiarcha Meyrick (Lepidoptera: Gelechiidae) on Cocos nucifera Linnaeus from India. Journal of Asia-Pacific Biodiversity. 1–8. https://doi.org/10.1016/j.japb.2021.04.004.2021.
- A taxonomic study of MethochaLatreille (Hymenoptera: Tiphiidae: Methochinae) from India with description of three new species. Zootaxa. 4999 (3): 258–272. 2021.
- Description of a new species of Yelicones Cameron, 1887 (Braconidae: Rogadinae) from Southern India. Zootaxa. 5016 (2): 294–298. 2021.
- A review of the genus SpilomenaShuckard (Hymenoptera: Crabronidae) with the description of six new species from India. Zootaxa. 5068 (2): 263–276. 2021.
- A new species of Notanisus Walker (Hymenoptera: Pteromalidae) from India. Halteres. 12: 49–53. 2021.
- Description of a new species of Antrocephalus Kirby (Hymenoptera: Chalcididae) from Kaippad paddy field of Kerala, India. Halteres. 12: 69–73. 2021.
- First discovery of the Neotropical species Brachymeriatrinidadensis (Hymenoptera: Chalcididae, Brachymeriinae) in India. Zootaxa. 5092 (4): 429–441. 2021.
- Chalcidid parasitoids (Hymenoptera, Chalcididae) of Phereoecauterella (Walsingham) (Lepidoptera, Tineidae): Description of a new species and the male of Epitranusuterellophagus from southern India. Systematic Parasitology. 99: 1–11. 2022.
- Evolutionary relic or a curious coincidence? A mantisfly emerging from a mud-dauber nest. Evolutionary Ecology. 36: 421–429. 2022
- Taxonomic studies of the genus ConuraSpinola (Chalcididae: Chalcidinae) from Oriental region with the first report of two New World species. Journal of Insect Biodiversity and Systematics, 8 (2): 245–256. 2022.
- A review of Taeniogonalos (Hymenoptera: Trigonalyidae) from India with the description of two new species. Journal of Natural History. 56(21–24): 1153–1185. 2022.
- Auplopuswahisi, a new species of spider wasp (Hymenoptera:Pompilidae) with biological notes from India. Journal of Asia-Pacific Biodiversity. 1–6. 2022.
- A peculiar case of parasitisation with two new species of wasps parasitizing the rice leaf-roller Pelopidas mathias (Fabricius, 1798) (Lepidoptera: Hesperiidae) from southern India. Systematic Parasitology. 99: 715–726. 2022.
- A review of digger wasp genus HarpactusShuckard, 1837 (Hymenoptera Crabronidae) of the Indian subcontinent, with description of a new species and rediscovery of Harpactusimpudens (Nurse, 1903), Zootaxa. 5190 (4): 531–542. 2022.
- A synopsis of the Oriental species of Thaumasura Westwood (Hym., Pteromalidae, Cleonyminae). Journal of Insect Biodiversity and Systematics. 8 (4) :551–558.URL: http://jibs.modares.ac.ir/article-36-62907-en.html. 2022.
- The Western Ghats, a biodiversity hotspot: the example of Chalcididae (Hymenoptera) with the description of a new species of Phasgonophora Westwood and a review of the regional species, Journal of Natural History. 56(41–44): 1627–1655.2022.
- A new species of Nesolynx Ashmead, 1905 (Hymenoptera, Eulophidae) parasitizing potter wasp, Delta pyriforme (Fabricius, 1775) (Hymenoptera, Vespidae) in its nest from southern India. Entomon. 47(4): 365–374. 2022.
Dr. J. Maya Devi
- Fine Balancing? A Study of Tha’mma’s Ambivalence in The Shadow Lines
Smt. Sangeetha G. Nair
- Perennial Wounds- Interrogating Women Consciousness with reference to Doris Lessing’s The Golden Note Nook and Selected Poems of Kamala Das, Singularities, A Trans disciplinary Biannual Research Journal – ISSN 2348-3369Vol 2. Issue 01 Jan 2015 Pg. 75-80. 2015.
- SreekumaranThampiyude Cinema gaanangaludeAaswadanam. Thunjan Research Journal Vol I, Issue 1, 2015- ISSN 2395-7770. Pg. 130-138. 2015.
- The Quandaries of the Underprivileged: Exploring the Lesbian Traits in Radcliffe Hall’s The Well of Loneliness. ‘’Roots’’, A Peer Reviewed, Refereed, Quarterly Journal with Impact Factor 0.811. ISSN 2349-8684 Vol:3 Special Issue 04 October 2016 Pg.103-105. 2016.
- Losing Into Life: Diasporic Consciousness in Kiran Desai’s The Inheritance of Loss . Critical Voices - South Asian History, Culture and Literature – Seminar Proceedeings. Winnweman’s Publications Pvt Ltd. Chennai- ISBN: 978-81-931937-0-9.Pg.89-96. 2016.
- Challenging the Social Norm: A Reading of Vikram Seth’s A Suitable Boy. Peer Reviewed UGC approved journal IJELLH (International Journal of English Language, Literature in Humanities) Vol. 7, Issue: 4 (ISSN-2321-7065). 2018.
Dr. Deepesh Karimpunkara
- Ramayana shilpathilorulikkothu (cmam-bW-inev]-¯nÂHcp-fn-s¡m¯v) An interview of the writer RameshanBlathur, based on his Novel PERUMAL, Published in Deshabhimani Weekly in 2015.
- MazhadaivangaleThakarthupeyyane - A special article based on Wayanad rain walk which is nature awareness trucking program for School students in 2013 , Published in MalayalaManorama Daily 2015 June.
- PeythirangunnavarThurakkunnaPaadapusthakam - A special article based on Wayanad rain walk which is nature awareness trucking program for School students in 2013 , Published in Malayalam Weekly 2016 August.
- ആമയും ആനയും ഒരു നാടോടിക്കഥയല്ല, Madhyamam Weekly, Page No. 84-88, ജൂണ് 4, 2018
- ചുള്ളിക്കാടിന്റെകവിതകളിലെപ്രേതായനങ്ങള്, അനുഭവവും ആഖ്യാനവും Publisher: Progress , Kochi – 18, DistributerPG & Research Department, Pala St.Thomas College, Pala, ISBN 978-93-5300-062-2 Page 9-12, 2018
- പി.കവിതകളിലെ ബന്ധസംഘര്ഷങ്ങള് , GRANDALOKAM, PublisherKerala Library Council, Kochi, Vol.70, book 2, Page : 49-53, 2019
- ഗാന്ധിബിംബങ്ങള് പി. കവിതകളില്, THUDI, Research Journal, Kannur University, Department of Malayalam, Vol.6 , BOOK 3 , Page No. 27-44, ISSN 2320-8880, 2019
- സൈബര്കാലത്തെഡിജിറ്റല്യാത്രാനുഭവങ്ങള് , THUDI, Research Journal, Kannur University , Department of Malayalam, Vol.7 , BOOK 4, Page No. 27-44, ISSN 2320-8880.
- ബഷീറിന്റെആത്മായനങ്ങള്, SAMAYAM MASIKA, Publisher, Padayalisamayam July 2019 , Kannur, Vol. 06 , Book 12, 2019
- എം.എന്.വിജയന് വ്യതിയാനങ്ങളുടെ ചിന്തയും വെളിച്ചവും, SAMAYAM MASIKA, Publisher, Kannur, Vol. 06 , Book 12, 2019
- സമത്വദര്ശകന്റെ ലോകായനങ്ങള്, Thunchathezhuthachan Malayalam Unuiversiy ,Thirur , 2019 , ISBN 9788193745847, sep 2019
- ആറ്റൂർ കവിതകളിലെ പ്രേത രൂപന്മാർ , കാവ്യരൂപന് - ആറ്റൂരോര്മ്മ, Olive Books , Kozhikkode, ISBN 93-89325-44-7, January
- NattormayileOnpathuPennungal, Bhashasahithi, https://www.keralauniversity.ac.in/journals.
- Naga Vijnaneeyam: navapdanasakhayudevyapthiyumsadhythakalum, Bhashasahithi, https://www.keralauniversity.ac.in/journals. 2021.
Dr. Megha P U
- Isolation and characterization of lytic coliphages from sewage water, Journal of pure and applied microbiology,0973-7510, 2581-690X, https://microbiologyjournal.org/. 2017.
- Phytochemical Screening and in-vitro antimicrobial activity of Pogostemonquadrifolius(Benth) of Lamiaceae, International Journal of Pharmaceutical Sciences and Research, 2320-5148, 0975-8232, https://ijpsr.com/. 2018.
- Nanosilica Entrapped Alginate Beqds for the Purification of Groundwater Contaminated with Bacteria, Silicon, 1876-9918, 1876-990X, https://www.springer.com/journal/12633/. 2021.
- Estimation of safe setback distance between well and contamination source using bacteriophage - a case study, Asian Journal of Microbiology, Biotechnology and Environmental Sciences, 0972-3005, http://www.envirobiotechjournals.com/journal_details.php?jid=1, 2017.
- In vitro screening of antioxidant and antiproliferative effect of Pogostemonquadrifolius extracts on cultured MCF-7 cell line, International Journal of Modern Biological Research, 2053-180X, http://www.bluepenjournals.org/ijmbr/index.php, 2017.
- Bacteriophage Formulations for the Reduction of Multi-Drug Resistant E. coli in Water Sources, Saudi Journal of Pathology and Microbiology, 2518-3362, 2518-3370, http://scholarsmepub.com/sjpm/. 2019.
- Perception among Infertile couples on the effects of Lifestyle on Fertility and Quality of Living, Journal of Basic and Applied Research International, 2249-3352, 2278-0505, http://www.pragatipublication.com/. 2019.
- Efficacy of Simarouba glauca herbal leaf powder as a hand wash product with potential antibacterial activity against pathogenic bacteria, Journal of One Health, Online: 2347 – 5757, http://www.jakraya.com/journal/joh, 2020.
Lt.Dr.SindhuKrishnadas.T.
- Women Empowerment , National Journal, Imperial Journal of Interdisciplinary Research, ISSN2454-1362, Vol-2,Issue2, 2016
- An Awareness of Health Insurance among Rural People of Kerala, International Journal,IJSR,ISSN No. 2277-8179,Impact factor 4.176, 2017.
- A study on the Trends and patterns of Consumer behaviour of college students. Journal of Emerging Technologies and Innovative Research, 2349-5162, http://www.jetir.org/. 2018.
- Ecotourism’s contributions to conservation: A case study of Nilambur. International Journal of Research in Humanities Art and Literature, 2347-4564, 2321-8878, https://www.impactjournals.us/journals/international-journals/international-journal-of-research-in-humanities-arts-and-literature. 2018.
- Economic impact of COVID 19 on educational sector with special reference to upper primary and lower primary students in Kozhikode District. International Journal of Research, 2348-6848, https://internationaljournalofresearch.com/. 2021.
- A study on the job satisfaction level of police in Kozhikode District. International Journal of Multidisciplinary Educational Research, 2277-7881, http://www.ijmer.in/. 2021.
- A study on the changes in the employment pattern of casual labours in Kakkodigramapanchayat during lockdown period. International Journal of Multidisciplinary Educational Research, 2277-7881, http://www.ijmer.in/. 2021.
- A study on the impact of COVID 19 on private bus operators in Kozhikode District. International Journal of Multidisciplinary Educational Research, 2277-7881, http://www.ijmer.in/. 2022.
Dr.Vineesh K.P.
- Neighbourhood V4-magic Labeling of some cycle related graphs, Far East Journal of Mathematical Sciences, 2019.
- NeighbourhoodBarycentric V4-magic Labeling of some graphs, International Journal of Research and Analytical Reviews, 2019.
- Neighbourhood V4-magic labelling of star and path related graphs, Journal of Discrete Mathematical sciences and Cryptography, 0972-0529, 2169-0065, https://www.tandfonline.com/journals/tdmc20. 2019.
- Neighbourhood V4-magic labelling of some graphs, Far East Journal of Mathematical sciences(FJMS), 0972-0871, http://www.pphmj.com/journals/fjms.htm. 2019
- Star magic labelling of some graphs, "Far East Journal of Mathematical sciences(FJMS)", 0972-0871, http://www.pphmj.com/journals/fjms.htm. 2019.
- Neighbourhood V4-magic labelling of some splitting graphs, International Journal of Research in Advent Technology (IJRAT), 2321-9637, http://www.ijrat.org. 2019.
Dr. Sayoojkumar K P
- Efficiency Evaluation of Public Sector Banks in India, International Journal of Emerging Technologies and Innovative Research, 2349-5162, http://www.jetir.org/. 2018.
- Financial Inclusion of Paniya tribal community in Kannur District of Kerala. International Journal of Emerging Technologies and Innovative Research, 2349-5162, http://www.jetir.org/. 2018.
- Measuring efficiency of Public sector banks and new generation private sector banks in India. International Journal of Research and Analytical Reviews, 2348-1269, http://www.ijrar.org/. 2018.
- Measuring Technical Efficiency of KSFE branches in Kerala. International Journal of Science and Research, 2319-7064, http://www.ijsr.net/. 2018.
Dr. Athma Jayaprakash
- Effectiveness of Internet Advertising on Consumer Behaviour, ISBN 9789382709954, 2015
- A Study on Stress Management, ISBN 78-81-926618-7-2, 2015
- The Effectiveness of Internet Advertising on Consumer Behaviour, ISBN 978-93-82709-95-4, 2015
- A Study on the Effect of Green Banking on the Economy, ISBN 978-81-931411-4-4, 2016
- A Study on the Effectiveness of Internet Advertising on Consumer Buying Behaviour Towards Mobile Phones, Peer reviewed International Journal Impact Factor 5.397 ISSN No 2249-555x, 2018
- Influence of Social Media on the Buying Behaviour of Consumers ISBN 978-93-87398-96-2, 2019.
- Attitude Towards the Use of Social Media among College Students, Our Heritage, Vol 68 No 21, ISSN: 0474-9030 Vol-68-Issue-21-December-2019.
- New Educational Platforms during Pandemic Impact on Rural College Students in Kerala, Sambodhi, ISSN No 2449-6661, Vol 43 no.3, Impact factor 5.80, September 2020.
- New Educational Platforms and emotional well-being during Pandemic on Rural College Students in Kerala, Journal of Engineering sciencesVol 13, Issue 03, March 2022, ISSN NO:0377-9254.
- Experiential Tourism: A New Perspective of Responsible Tourism Initiative in Kerala, Education and SocietyISSN: 2278-6864 (UGC Care Journal) Vol-46, Issue-4, No.-07, October-December: 2022.
- Purchasing Behaviour of Consumers Towards Shopping Mall In Kozhikode District Rabindra Bharati Journal Of Philosophy, ISSN: 0973-0087, Vol. XXIII, No:24, 2022.
Dr.Vijaytha Vijayakumar
- Designing ofenzyme inhibitors based on active site specificity: lessons from methyl gallate and itslipoxygenase inhibitory profile. Journal of Receptors and Signal Transduction, 38(3),256-265. 1079-9893, 1532-4281. 2018.
- Phytochemical profiling, and anti-oxidant, anti-bacterial, and anti-inflammatory properties of Viburnum coriaceumBlume. Future Journal of Pharmaceutical Sciences, 6(1), 1-13. 2314-7253,2314-7245. 2020.
- Nutraceutical Legumes: A Brief Review on the Nutritional andMedicinal Values of Legumes. Sustainable Agriculture Reviews 51, 1-28. 978-3-030-68828-8. 2021.
- Impact of air pollution andsmoking on COVID-19: a review. The Egyptian Journal of Bronchology, 15(1),1-8. 2314-8551. 2021.
Dr. Joobi V.P.
- Consumer Expectation in Virtual Marketing Environment, UGC Seminar Proceedings, 2015.
- Online Era of Banking, ISBN 9788193141144, 2016.
- Local Community Participation in Responsible Tourism - A Case of KumarakamPanchayath in Kerala, International, ISSN: 2456-0979, 2017
- Responsible Tourism- a Path Way to Women Empowerment, International SARA Publishing Academy ISSN: 2249-555X, 2018.
- Socio- Economic Impact among Local Community by way of Responsible Tourism – A Case of Wayanad District of Kerala, Two-day National Seminar Proceedings, 2019.
- Purchasing Behaviour of Consumers towards Shopping Mall in Kozhikode District”, Rabindra Bharati Journal of Philosophy, Vol. XXIII, 0973-0087, 2022.
- Experiential Tourism: A new perspective of responsible tourism initiative in Kerala”, Education & Society, Vol 46. Issue 04, No.07, 2022.
- A study on the impact of COVID-19 on the micro, small and medium enterprise performance in Kerala”, South Indian Journal of Social sciences, Vol XXI, Vol 11, 0972-8945, 2022.
- Travel Behaviour and Perception of Domestic Travelers during COVID-19 Pandemic”, Shodhsamhita: Journal of Fundamental & Comparative Research, Vol VII, No. 9, 2277-7067, 2021.
- Tourists’ Perception on the Role of Hospitality Sector in Rebuilding Travel & Tourism During COVID-19 Pandemic”, Journal of Education: Rabindra Bharati University, Vol XXIII, No.: 9,0972-7175, 2021.
- The Impact of Environmental Dimension of Responsibilities in Responsible Tourism of Hospitality Sector”, Kalyan Bharati: Journal on Indian History & Culture, Vol. 36, No.9, 0976-0822, 2021.
- Tax Awareness and Tax Planning: A comprehensive Study on Attitude of Individual Assesses Towards Tax Planning on Wealth Creation”, NIU International Journal of Human Rights, Vol. 8(XX),2394-0298, 2021.
- Factors Influencing the Choice of Savings and Investment Avenues among Teachers”, International Journal for Research in Engineering Application & Management (IJREAM) Vol-06, Issue-01, 2454-9150, 2020.
- Environmental Responsibilities of Hospitality sector in Responsible Tourism, MuktShabd Journal, 2347-3150, http://shabdbooks.com/. 2020.
- Awareness and Attitude towards Tax Planning on Wealth Creation of Individual assesses”, MuktShabd Journal, 2347-3150, http://shabdbooks.com/. 2020.
- Attitude Towards the Use of Social Media Among College Students”, Our Heritage, Vol-68-Issue-21, 0474-9030, 2019.
Dr. Priya R S
- Use of concomitants of record values in the estimation of parameter µ2and σ2 involved in involved in morgenstem type bivariate exponential distribution, International Journal of Statistics and Applied Mathematics (2022), Vol 7, Issue 4, Part B, 110-118, ISSN: 2456-1452.
- Symmetric Beta-Cauchy distribution and estimation of parameters using order statistics, Calcutta Statistical Association Bulletin (2017), Vol 68, 111-134, ISSN 0008-0683.
- An application of ranked set sampling when observations from several distributions are to be included in the sample, Communications in Statistics-Theory and Methods (2016), Vol-45, No-23, 7040-7052. ISSN-0361-0926.
- On a less cumbersome method of estimation of parameters of Type III generalized logistic distribution by order statistics, STATISTICA (2015) anno LXXV, No-3, 291-312, ISSN 1973-2201.
- A note on use of some functions of spacings in the estimation of common scale parameter of several symmetric distributions. Communications in Statistics-Theory and Methods (2015). Vol-44, 2924-2932, ISSN-0361-0926.
Dr. N.K. Divya
- Photoluminescence quenching and photocatalytic enhancement of Pr doped ZnO nanocrystals, N.K. Divya, P.P.Pradyumnan, Bulletin of Materials Science 40 (2017) 1405.
- High dielectric constant, low loss and high photocatalytic activity in Gd doped ZnO systems, N.K. Divya, P.P.Pradyumnan, Materials Research Express 4 (2017) 015904.
- Enhancement of photocatalytic activity in Nd doped ZnO with an increase in dielectric constant, N. K. Divya, P. P. Pradyumnan, Journal of Material Science: Materials in Electronics 28 (2017) 2147.
- Solidstate synthesis of erbium doped ZnO with excellent photocatalytic activity and enhanced visible light emission’ N.K. Divya,P.P.Pradyumnan, Materials Science in Semiconductor Processing, 41(2016) 428.
- ZnO:Gd nanocrystals for fluorescent applications, N. K. Divya, P. P. Pradyumnan, AIP Conference Proceedings 1731(2016) 050005; doi: 10.1063/1.4947659
- Dielectric property study of Erbium doped ZnO nanocrystals”, N.K Divya, P.U Aparna, P.P Pradyumnan, Advances in Materials Physics and Chemistry, 5 (2015) 287.
- Structural and Dielectric Studies of Gd Doped Zno Nanocrystals at Room Temperature, P. U. Aparna, N. K. Divya, P. P. Pradyumnan*, Journal of Materials Science and Chemical Engineering, 4(2016)79.
- Hotoluminescence quenching and photocatalytic enhancement of Pr doped ZnO nanocrystals, Bulletin of Materials Science, 0250-4707, 0973-7669, https://www.ias.ac.in/Journals/Bulletin_of_Materials_Science/. 2017.
- High dielectric constant, low loss and high photocatalytic activity in Gd doped ZnO systems, Materials Research Express, 2053-1591, https://iopscience.iop.org/journal/2053-1591. 2017.
Ms. Lesitha K R
- The effect of boric acid and sucrose in pollen germination of impatientsbalsamina, Education times, 2319-8265, https://portal.issn.org/resource/ISSN/2319-8265. 2018.
- An inventory on anatomical and systematical features of selected herbs at kalarikunnu. Edu World, 2319-7129, https://portal.issn.org/resource/ISSN/2319-7129. 2018.
Dr. Bindu M K
- PravasathinteAavishkaramGaddhamayil, MalayalaVimarsham, 2349-9230. 2017.
- Pravasam: CharithravumVishakalanavum, Thudi Research Journal, 2320-8880, Print Journal. 2020.
Dr. Anusmitha N
- History of Television Serials and their influence, Ezhuthadayalam, 2017
- The Travelogue of Anand, Article in the book published by Haritham books, 2017
- Role of social media in revolutionizing communication in India, International Journal of Innovative Technology and Exploring Engineering, 2278-3075, https://www.ijitee.org/wp-content/uploads/papers/v8i12S2/L100810812S219.pdf.2019.
- NavamadhyamangalilePuthu Bhasha Pravanthakal, Thudi Research Journal, 2320-8880. Print Journal. 2020.
Ms. Saraja R
- Ashokan MarayurinteKavithakal, Thudi Research Journal, 2320-8880, Print Journal. 2018.
- Rajan KakkanadanteYathraVivaranangalOruPadanam, Thudi Research Journal, 2320-8880, Print Journal. 2019.
- PravasaJeevithamDubaippuzhayil, Thudi Research Journal , 2320-8880, Print Journal. 2020.
- ParisthithyDarsanamEnmakajail, Thudi Research Journal, 2320-8880, Print Journal. 2020.
Dr. Santhosh C R
- Adwita Vedanta darsananthargate vivarana prasthane sidhantitam aparoksha pramitijanakattwam, Kiranavali, UGC Care listed journal,Vol.XIII. Book.I-IV, January - December 2021, Sanskrit Research Foundation, Thiruvananthapuram, ISSN 0975-4067
- Njanasya njanakarmasamucha yasya ca mokshahetutwa vishaye isavasya dhishtita darsanika meemamsa, Kiranavali, UGC Care listed journal, Vol.XIV. Book.II, April - June 2022, Sanskrit Research Foundation, Thiruvananthapuram, ISSN 0975-4067
- Bharata sootrattinte saidhantika talangal, Thudi, UGC Care listed Research Journal, Vol.10, Book 2, April - June 2022, Kannur University, Kannur, ISSN2320-8880
- Malayala nattile vishu vutsavavum marunadarude koyttutsavangalum, Nibandhamala, UGC Care listed Research Journal, 12th Edition 2022, Central Sanskrit University, Guruvayur campus, ISSN 2277- 2359
- Tattwa pradeepikayah swarupam, pratipadyah, vyakhyasca, Nibandhamala, UGC Care listed Research Journal, 10th Edition 2020, Central Sanskrit University, Guruvayur campus, ISSN 2277- 2359
- Natyasastra and it's rich traditions, Worldwide International Interdisciplinary Research Journal, Vol.1, Issue III, December 2015, ISSN 2454-7905.
- Tattwasastrechitsukhaprakasitamswaprakasattwamityadwitatattwam,Kiranavali, UGC Care listed Research journal,Vol.XIV. Book III&IV, July - December 2022, Sanskrit Research Foundation, Thiruvananthapuram, ISSN 0975-4067
- Adwita Vedanta darsanasya antharikah vikasaparinamah, Pratyabhijna, UGC Care listed Research Journal,Vol.VIII, Issue. II, January 2022 - June 2022, SreeSankaracharya University of Sanskrit, Kalady
Ms. Thulasi P V
- Studies on partial and total photon interaction parameters in the energy range 1 keV-100 GeV of some synthetic polymers having medical applications, Radiation Physics and Chemistry, 0969-806X, https://www.sciencedirect.com/journal/radiation-physics-and-chemistry. 2021.
- Effective atomic number studies in coconut oil samples using 662keV gamma rays. AIP Conference Proceedings, 0094-243X 1551-7616, https://aip.scitation.org/. 2021.
Books Authored/Edited by Faculty
since November 2016
Dr. DeepeshKarimpunkara
- ഇലകൾപച്ചപൂക്കൾമഞ്ഞ, കവിതാസമാഹാരം, എഡിറ്റർ, മിത്രബുക്സ്, കോഴിക്കോട്, 2015.
- ദേശചരിത്രങ്ങൾ, എഡിറ്റർ, മിത്രബുക്സ് , കോഴിക്കോട്, 2015.
- മലയാളികളുടെമാർക്കേസ്, എഡിറ്റർ, സമയംബുക്സ്, കണ്ണൂർ, 2015.
- കഥപറഞ്ഞുപറഞ്ഞ്കഥയായൊരാൾ, എഡിറ്റർ, ഐബുക്സ്കേരള , കോഴിക്കോട്, 2019 ജനുവരി, ISBN 936762604-9.
- തിരക്കാഴ്ചയിലെപുതുലോകങ്ങൾ, ഐബുക്സ്കേരള ,കോഴിക്കോട്, 2019 സെപ്തംബർ, ISBN 93- 6762627-8.
Dr. Santhosh C R
- Bharata muniyude natyasastram, Karali books,Kannur 2015
- Natyasastrattile rasabhavangal, Kerala Sahitya Academy, Thrissur 2021
- Daivadasakam Guruvinte Mahayanam, Mythri Books, Thiruvananthapuram, 2021
Awards/other achievements by Faculty
since November 2016
Dr. Devipriya V.
- Executive Council Member of Society of Cytologists and Geneticists, India from 2012 -2016 and from 2017 -2021.
- Executive Council Member of Indian Association for Angiosperm Taxonomy from 2012 -2014 and from 2018-2020.
Dr. Anusmitha N
- State Award for Best NSS Programme Officer (2015-16)
- University Award for Best NSS Programme Officer (2015-16)
- University Award for Best NSS Programme Officer (2014-15)
Dr. Santhosh C R
- Abhayadev award 2021
- Kerala Kalamandalam award 2021
- Gurudarsana award 2021